PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0065s00100.1
Common NameLR48_Vigan06g107700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 398aa    MW: 43389.6 Da    PI: 6.286
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0065s00100.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.2e-15130174146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg W + Ed +l+++v+++G+ +W++Ia+++  gR+++ +k++w+ 
  Vang0065s00100.1 130 RGHWRPAEDSKLKELVALYGPQNWNLIAEKLE-GRSDNAVKNHWHV 174
                       899*****************************.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.387125180IPR017930Myb domain
SMARTSM007173.2E-13129178IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-16129182IPR009057Homeodomain-like
SuperFamilySSF466893.14E-13130183IPR009057Homeodomain-like
PfamPF002494.4E-14130173IPR001005SANT/Myb domain
CDDcd001672.22E-12133173No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MISSQQNQNA PTCYPFPSSP SMGMVCADMM GSLSLATVSN ALSSQESFGY GHHHGHASGL  60
ENGRSTSWSF PFMREFLSSN FEDCSDVGAG ESNSNEKTNN NGKFSEESNP NENLLSGKEV  120
DSGHSKLCAR GHWRPAEDSK LKELVALYGP QNWNLIAEKL EGRSDNAVKN HWHVIMARKY  180
REQSSAYRRR RMSQSVYKRV EQNPTFCSRD NASTTEQEPS PSYCLNLLHN GVGVTNNLAS  240
FPSFHGVGSG EVVDFGLNAS LQNMNGVREA MSNTLQVGLR AQAQQAPFDF FSGGGSNDMT  300
GESNGQIRSW ERSNESVQSG LYPHYPQQYL RAMQQLENNT RNNFYSFLNS SSASASTGKE  360
ASSSSACVAG MRDKVVNSDP PDGVPPPFFD FLGVGAT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014519753.10.0PREDICTED: uncharacterized protein LOC106776799
TrEMBLA0A0L9USS30.0A0A0L9USS3_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T2050.0A0A0S3T205_PHAAN; Uncharacterized protein
STRINGGLYMA01G05980.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.16e-28myb domain protein 105
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]